CAZyme Information: MGYG000000032_04725

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_04725
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	MGYG000000032_16|CGC1	64093.42	5.3324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 96769; End: 98481 Strand: +

Full Sequence      

MNVDFKARPFFLDESDIAWVQDCMKKMTVEEKVSHLFCILIKDKPVEEMAAEMDALGFYP
GGYMTDVFPARKVKENFKKLQARTGIPLLFASNLERGADGICKEGTLFGTQMQVAAAGDK
RWAYELGRVCGEEAAATGANWNFGPILDIDTNYHNPITNTRVFSSDQETVLQMSREFVRG
QMENGMAVCLKHWPGDGRDERDQHMVTTINDCTAREWDASYGKIYKALIEDGAETVMAAH
IMLPAYSRKMNPDIRDEEILPGSLSCDLTTRLLREQLGFNGLVVTDATTMTGFMQTMARR
DALPLAVAAGCDMILFTLDLKEDYQYVLDAAADGTISRERLDEAVARILALKAHLKLHKK
MEEGTLFPGDEALKVFEREDNRNLARECADRSVTLVKDTQNLLPISPKTQRRILLHVLGD
KGGYHDPICNQAEYLAGLLEREGFEVTVYDASRKDLLPIGNSIESMTKRFDLILYYCSVK
TSGSDNVSRISWTAPGGCNTPRYIYEIPTLFISVDNPYMLLDVPKVRTYINGYTPSRYVI
DAIVEKIMGRSRFTGKNPVDPFCGLFHTRL

Enzyme Prediction     

No EC number prediction in MGYG000000032_04725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	315	9.7e-53	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.15e-53	77	351	57	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	8.24e-26	105	315	85	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.64e-19	18	415	36	415	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ14596.1	1.80e-285	5	570	8	577
QTQ11232.1	2.42e-283	5	566	8	573
QTQ16835.1	1.83e-249	5	517	8	525
QQO07738.1	1.77e-236	3	570	5	572
ASA19767.1	3.95e-192	3	570	2	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	3.10e-154	8	570	9	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	8.16e-45	81	560	111	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.89e-44	81	560	85	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.15e-44	81	560	115	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	3.44e-38	25	558	9	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.73e-148	3	570	2	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	4.47e-44	81	560	111	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.07e-24	81	410	93	430	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A0KXK3	2.16e-19	115	319	86	282	Beta-hexosaminidase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=nagZ PE=3 SV=1
Q0HJG7	2.16e-19	115	319	86	282	Beta-hexosaminidase OS=Shewanella sp. (strain MR-4) OX=60480 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_04725.