CAZyme Information: MGYG000000032_01082

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_01082
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828	MGYG000000032_2|CGC5	95907.79	4.6683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 271077; End: 273563 Strand: +

Full Sequence      

MEHRITLNGTWNWCDMESKEWHKGIVPGTVLTDMMDGGLIEDPYWRTNEYETRELSRRDY
QYEREFEVPESFFREEEQCLVFEGLDTIADIYLNDELLLAVNDMHRTWRIDVKGKLKAVN
RLAVAFHSPTAFIEKADREGDIFYASTGCMKGNGALRKAHYMFGWDWGPQLPDAGIFRSV
YLSGFSIARLDDVRIRQEHGAGGVKLSVESSVRKLSESDTAGNGMLVCKITAPDGTVFTV
EKEVGINETIEALIEAPQLWWPNGYGAQPLYTVRVELRMSDSVLDVWERTIGLRTVTVCT
DADEWGNQFAFVVNGQKIFAMGANYIPEDNLLGHLSEERSERLIRDCARANFNCIRIWGG
GYYPEDYVYDACDRYGILVWQDLMFACNVYDLNDEFEANILAETADNVKRIRHHACLGLW
CGNNEMEWGWRDWGRLEGHRPKYKADYTKIFEMLLPRLVKQVDDQTYYWLSSPSSGGSFD
DPNDFNRGDNHYWEVWHSNKPFTEYRDFYFRFCSEFGFQSFPGKKTLDSFSLPEDQNIFS
EVMESHQKNGLANTKIFSYISGYYKYPKDMESIAYISQILQLKAIQYGVEHWRRNWGRCM
GSIYWQLNDCWPVASWASIDYYGRWKALHYGAKRFYARFMATACEKEELSTEIDYYIHNE
SFEERKAVLRVRLIDRDFHTLYETEREITAAAFEVKNVLPMDFAPFLAEAGMKKRAVAEY
SLIEDGCVVSRGTTLFVKPKYFDFKTPEYRISVAEKADVFCIHADADTYVSYAELSLDGY
DVVLEDNFFDITSEEGVDITVDKKEFPNQVTAEEVAAALHIRSVADSF

Enzyme Prediction     

No EC number prediction in MGYG000000032_01082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	685	2.3e-110	0.6715425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.64e-97	1	637	9	630	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	7.38e-11	188	294	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	6.16e-10	651	741	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.05e-09	747	826	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	9.42e-09	174	429	195	453	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18719.1	0.0	1	828	1	826
QQO08489.1	0.0	1	828	1	828
SET87559.1	0.0	1	828	1	836
QRV20341.1	5.98e-318	1	828	1	845
ADL05496.1	5.98e-318	1	828	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	7.88e-145	5	825	6	851	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	8.09e-145	5	825	6	851	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.75e-144	5	825	4	849	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.91e-144	5	825	6	851	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	4.40e-143	5	681	9	694	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D911	1.05e-96	25	634	31	651	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	3.95e-96	25	634	31	651	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.48e-95	25	634	31	651	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	2.85e-95	4	634	6	651	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A2QYN2	1.45e-94	4	634	6	651	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_01082.