CAZyme Information: MGYG000000031_01629

Basic Information

• Species: Blautia_A sp900066205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900066205
• CAZyme ID: MGYG000000031_01629
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000000031_4|CGC4	54973.41	8.8649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000031	3671868	Isolate	United Kingdom	Europe

• Gene Location: Start: 281037; End: 282551 Strand: -

Full Sequence      

MRLVESFLTKNPCYTAGRKITVKGLMLHSVGCPQPRAQVFLDSWNCASFGSACVHGFIDG
NDGTVYQALPWNHRGWHCGSGSKGSGNNTHIGVEMCEPACIRYTSGSGFTCSDLEKARAS
AVRTYEAAVELFAMLCKKFGLDPLADGVVISHREGHARGIATNHGDPEHLWKGLGLPYTM
SGFRKAVKAAMSGKAGGAQASVFLGLSDEKAAERIGVLCAENMKTSGILASVSAAQFILE
SGYSRTELAQKANNCFGMKCMLSGNSWGGSAWDGTSKYRKKTQEDDGTGKLYTVTADFRK
YACVEQSIADHSAYLLGAMNGKKKRYAGLAGEKDYRKAVQIIKDGGYATDSLYVQKICGI
IEKYGLTRFDGGKTEKEIWYRVRKNWQDAESQVGAFKVLENAKKSADEHPGFSVFDENGK
AVYSSVDKKQEEVFRPYLVRVEISDLNIRKKPGTDQEKTGKYTGAGCFTIVAEADGVGAS
KWGLLKAYEKERNGWISLDFVTRI

Enzyme Prediction     

No EC number prediction in MGYG000000031_01629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	221	366	1.9e-25	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.70e-39	173	375	16	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	5.31e-25	221	370	173	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK06347	PRK06347	5.66e-24	230	374	172	307	1,4-beta-N-acetylmuramoylhydrolase.
cd06583	PGRP	3.02e-20	22	167	2	123	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
PRK08581	PRK08581	3.19e-19	228	410	340	509	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ98955.1	4.89e-206	1	504	1	539
AMP42248.1	8.87e-188	1	502	1	454
AFC63685.1	2.27e-159	1	504	1	498
ADL53623.1	4.58e-151	1	504	1	488
QJU15163.1	4.41e-125	1	423	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	2.93e-13	210	402	69	245	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	2.37e-08	220	361	13	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.79e-08	220	361	14	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.73e-07	220	361	14	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3HMB_A	1.59e-06	61	99	64	101	ChainA, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_B Chain B, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_C Chain C, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.66e-18	228	370	68	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	3.60e-12	210	402	329	505	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P54450	4.69e-06	61	99	61	99	N-acetylmuramoyl-L-alanine amidase CwlH OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlH PE=1 SV=1
P39046	7.35e-06	224	370	78	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
A2RHZ5	7.63e-06	226	374	80	218	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000031_01629.