CAZyme Information: MGYG000000029_02057

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_02057
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531	MGYG000000029_9|CGC5	60164.28	4.8139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 199663; End: 201258 Strand: +

Full Sequence      

MKNKYILLGLSCLAALCSCSDDKAFEPDYLPKITSDHAMTSTVNVADKHQVIDGFASSDA
WTMDYIGKYWSNNAKEGIAKLLFSQKIERGNPEGIGLSMWRVNLGGGTAEQGEASGITDK
TRRVECFLTQNGTYDWNKSSGQQYFMQKAKEYGCNNFVLFSNTPPVQFTVNGKGSGDWWN
NNLREDCFDDFADFLATVAKHFSDNGYNISYISPLNEPQYSWGGDGQEGCSWQHVHVAKM
ARALNESLKTKGPENTMMLLAEAAKVPYLYTTDDSWADRANVIPTYFKSDSEHYLGDLER
MPKLICAHSYWWDKTWDVLFDSRTKARAEADKYGLKLYQTEWSMLGEGYEDYENYDQATY
MDLALSMAKVLHHDLVTASMNSWAYWTTASQEVYSQKSRFYMIRLIPTGGDYGNIADGGT
YESSKNLWVLGNYSLFVRPGYHRVDLNIPEGDKKFFGSAYISPEEDKLVVVYTNINDESI
QMETSIEGLNKQVVSMRQYVTSSTSNLNEVDEYLKGYIPAKSVVTMVYDLK

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	41	527	7.7e-164	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.46e-113	43	395	6	362	O-Glycosyl hydrolase family 30.
COG5520	XynC	4.83e-16	42	530	37	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93356.1	2.38e-228	1	531	1	530
QGT72500.1	2.33e-226	1	531	1	541
ADY36080.1	3.87e-170	1	531	1	541
ALJ59966.1	1.67e-167	42	531	43	535
SCD19763.1	1.81e-167	1	529	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.87e-78	38	529	2	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4FMV_A	6.97e-17	42	527	6	385	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
5CXP_A	1.60e-16	41	529	6	388	X-raycrystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, Xyn30A, from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6M5Z_A	2.23e-13	40	527	24	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	3.09e-12	40	527	11	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	5.64e-13	40	252	23	247	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	1.26e-11	40	527	28	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q6YK37	7.69e-11	146	527	99	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
Q45070	5.12e-08	146	527	98	419	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000029_02057.