CAZyme Information: MGYG000000025_00198

Basic Information

• Species: Staphylococcus nepalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus nepalensis
• CAZyme ID: MGYG000000025_00198
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000000025_1|CGC4	64450.84	5.2062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000025	2822370	Isolate	United Kingdom	Europe

• Gene Location: Start: 206346; End: 208070 Strand: +

Full Sequence      

MVKVDLTAAPYYLNTDQITWVEETLNNLTDEEKIGQLFFNLFSLEGGKKFYDADLTNEDV
LKRYHIGGARYEGGNKEDVQHLLNDLQKHTKVPVLVAANCDSGGNGACKDGTYIASAAQC
EAAQDTKVAYNAGLVSARESSALGVHINFDPCVDILKNWRNTIVNTRSYGTDAETVIKYS
SAFIDGFNAERNMITCIKHFPGDGTEERDQHLVLGVNELTTQEWDDSFRKVYQHHIDRGV
QMIMAGHIAQPAYSKKLNPNLEDKDILPATLSSELITDLLKDDMKFNGLVVTDASHMLGM
TASMRREDYVPLAIASGCDMFLFFNDLEEDYQFMLKGYEKGVITEERLNDAVRRVLGLKA
QLSLHKKQKDGSIIQPKEALDIIGCTEHLEMRAEAADLGITLVKNTLNQLPIRPETHKNI
MLYVIEGEKDGIYKSANNVADDIIKELESRGFNVTLNDGSTRIKGKTLAYRNNVDAALVF
ANIIGYAAENNYRIKWGTAMSNEIPWYVHEVPTVFVSTNFTTHLHDATMVKAYINAYHSN
HETIKQTIDKIMGESEFKGAYNDLVWTDKWQAKL

Enzyme Prediction     

No EC number prediction in MGYG000000025_00198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	322	1.1e-47	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.59e-62	28	418	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.99e-55	29	358	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	8.07e-22	113	326	83	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.31e-15	21	413	38	408	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATH64367.1	0.0	1	574	1	574
AWI43726.1	0.0	1	574	1	574
ATH59274.1	0.0	1	574	1	574
QKU18739.1	0.0	1	574	1	574
QQV53396.1	0.0	1	574	1	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.22e-116	6	574	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	6.37e-45	23	445	37	477	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.25e-44	23	445	11	451	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.24e-44	23	445	41	481	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	4.74e-32	28	405	11	378	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	3.34e-116	4	574	2	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	3.49e-44	23	445	37	477	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C3LSU7	2.51e-22	51	328	11	277	Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=nagZ PE=3 SV=1
A5F8Y1	2.51e-22	51	328	11	277	Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=nagZ PE=3 SV=1
Q9KU37	2.51e-22	51	328	11	277	Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000025_00198.