CAZyme Information: MGYG000000024_00772

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_00772
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	MGYG000000024_1|CGC11	83479.79	4.7091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 787746; End: 789989 Strand: +

Full Sequence      

MNIKELIKQMSLEEKASLCSGLNFWNTKPIERLNIPSIMMTDGPHGLRKQSEGADHLGIN
ESVEATCFPTASALACSFDRDLVKELGIAIGEECQSENVSIVLGPGANIKRSPLCGRNFE
YYSEDPYLSSEMAKNQIQGTQSQGIGTSLKHFAANNQEHRRMTIDTIVDERTLREIYLAS
FETAVKEAHPWTVMCAYNKLNGEYCSENYRLLTEILRNEWGFEGFVVSDWGAVNDRDKGL
SSGLELQMPADGGMGDNLIVEAVKRNRLSEGVLDEAVERILNIIFKAVENKRENVIYSKE
KHHELARKIAGECMVLLKNEEKILPLKKEENIAVIGELATKVRYQGGGSSHINPTKVDNA
YEEIVNFAGTENVRYARGYDLSIDDTIYDLAEEAKKLAIEADKVILFIGLPERYESEGFD
RTHLNIPKNQYDLVKTLKSVNENIVVVLSNGSPIEMPFLSDVKAILEAYLTGQASGKAIC
DLLYGEVNPSGKLAETFPLKLSDNPSYLNFPGEVDKVEYKEGIFVGYRYYDKKAMDVLFP
FGYGLSYTNFEYSNLKISKNEIDDTEKVTVSVNIKNIGDVFGKEIVQLYIRDKESSVTRP
EKELKGFGKIGLDPGEEKEVTFILNKRSFAYYNVDLGDWHVESGEFEILIGKSSREIVLK
EVITVNTTSPIKTIVTKNTALGDIAHLPEVQQIINAMIQSFGGDTSGLGEGNMFEEMMKF
MPLRALATFNPDGGQQLVDRIIESINS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	245	6.7e-68	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.58e-109	3	657	38	757	beta-glucosidase BglX.
COG1472	BglX	1.58e-73	32	365	57	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.12e-68	314	527	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	2.02e-62	6	625	56	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.26e-39	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA07549.1	0.0	1	746	6	751
AVR00322.1	0.0	2	746	4	754
QUG84566.1	0.0	2	746	4	757
QNF28679.1	0.0	2	746	4	757
QIZ07551.1	0.0	2	746	3	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	0.0	1	747	3	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.27e-206	7	737	9	735	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	2.38e-150	2	658	5	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	3.73e-148	3	665	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3ABZ_A	1.57e-147	2	658	5	829	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	0.0	1	747	3	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.84e-204	7	743	9	750	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.40e-200	7	743	9	750	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.10e-147	1	657	44	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	3.14e-145	1	668	4	833	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000024_00772.