CAZyme Information: MGYG000000020_00698

Basic Information

• Species: Latilactobacillus curvatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus curvatus
• CAZyme ID: MGYG000000020_00698
• CAZy Family: GH38
• CAZyme Description: Mannosylglycerate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MGYG000000020_8|CGC2	70151.71	4.9483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000020	1923680	Isolate	United Kingdom	Europe

• Gene Location: Start: 54783; End: 56633 Strand: -

Full Sequence      

MRIHKSIFSSRSDLKQLNTETQNYLINTMEPLLSLGMAYGLKYPVETVREIWRLMFENAA
HDSIGACVSDTTNEDVYMRYKQVRDIASNLVELTLREIATRIGNPQSKEIPLTFFNPLST
VQNGVVEVECYVPQKEFGILDEQGNEIAYTILEFVDQTEYVLNQGNILDLSKDIFIPNKV
YKAKIALQLNDVPSVGYVQYTIDLHRNTLTELIEQKREILENEALQITINDNGSLDILDK
KTATTYRNQTILEENGDDGHSFNYSPPRNDLKIQSIEFKPVIKVVNSAILEVATITYEMI
VPKDLEERAEGIQSTRLPVTIVVKLAKGQSTIDFEVAIDNRWVDSHRLCALFDAGIASKV
STADQQFGLIQRPVVRRSEMDLWQSDQEKWNEKPLSIETCQSFVTLNDAQKGIAIFPKGV
REYEIVGEKYDTIRLTLFRTYGYMGKENLVYRPGRASGESVVKTPNSQCHKQLKFSFSAY
YYQGNVNSGEVANSAKIANTRPLVYEYADFLNSRLIFTQSEVQKDLFVSDSLFKTNGHLT
LSVIKKAEERPGMIVRLYNGHVDDELDDTIMFEKTITKAELVDLKEETIGALEVYSNTIK
VPTQKHAKFVTVYVEF

Enzyme Prediction     

No EC number prediction in MGYG000000020_00698.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	0.0	1	615	277	875	mannosylglycerate hydrolase.
COG0383	AMS1	1.12e-52	4	559	304	891	Alpha-mannosidase [Carbohydrate transport and metabolism].
pfam09261	Alpha-mann_mid	3.07e-14	4	98	3	98	Alpha mannosidase middle domain. Members of this family adopt a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. They are predominantly found in the enzyme alpha-mannosidase.
pfam07748	Glyco_hydro_38C	6.85e-14	220	440	1	197	Glycosyl hydrolases family 38 C-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
smart00872	Alpha-mann_mid	1.24e-12	4	80	2	79	Alpha mannosidase, middle domain. Members of this entry belong to the glycosyl hydrolase family 38, This domain, which is found in the central region adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN60910.1	0.0	1	616	277	892
QAR36284.1	0.0	1	616	277	892
AZP95655.1	1.52e-279	219	616	1	398
AXN36662.1	1.24e-278	219	616	1	398
QXJ59706.1	1.64e-257	1	615	277	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KBP_A	6.80e-36	9	559	301	849	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	1.65e-33	9	559	301	849	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
2WYH_A	2.94e-30	9	567	321	882	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54746	4.59e-80	1	576	278	838	Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
Q9KER1	5.06e-32	9	565	298	851	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000020_00698.