CAZyme Information: MGYG000000013_04858

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_04858
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883	MGYG000000013_20|CGC1	101837.84	6.0194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 1888; End: 4539 Strand: +

Full Sequence      

MKFAEKTISLNPLISNAPTMMINLIGKKAQIACGLLCCCSMVYAQSNDNSEVVVLNTGWE
FSQAGTELWQSAQVPGTVHQDLINHKQIPDPFYGINEQKIQWVENEDWEYRTAFTVTPEQ
LKRDDAQLVFEGLDTYADVYLNGALLLKADNMFVGYTIPVKSQLRIGENLLHIYFHSPIR
QTLPQYNSNGFNYPADNDHHDKHLSVFSRKAPYSYGWDWGIRMVTSGIWRPVTIRFYDAA
FISDYHVKQLALTDQLANLSNELEINNILSRPLQAEVRINTSFEGSAEKSINQAITLQPG
INHVSIPSEVAFPVRWMPNGWGKPALYDFSAQIIVEDKVVAEQSHRIGLRTVRLVNEKDK
DGESFYFEVNGVPMFAKGANYIPQDALLTNVTTERYQTLFRDIREANMNVIRVWGGGTYE
DDRFYDLADENGILVWQDFMFACTPYPSDPTFLKRVEAEACYNIRRLRNHASLAMWCGNN
EILEALKYWGFDKNFPPEIYQEMFRGYDKLFHQLLPAKVKELDAARFYIHSSPYFANWGR
PESWGIGDSHNWGVWYGQKTFESLDTDLPRFMSEFGFQSFPEMKTISTFAAPEDYQIESE
VMNAHQKSSIGNALIRTYMERDYIIPEKFEDFVYVGLVLQGQGMRHGLEAHRRNRPYCMG
TLYWQLNDSWPVVSWSSIDYYGNWKALHYQAKRAFAPILINPIRQNDSLNIYLISDCPDT
KDHLMLEMKVTDFDGKKQGKPIRLNTLSVPANTSQCVYRIKPDIWLSPEEQQRCFMQLTL
KDKAGNTLAETVYFFRKTKDLLLPETTVSCKMKQKDGMCELTLFSPTLAKDVFIEIPLQG
ARFSDNFFDLLPRERKTVVITSPQIKKGEELPLTIKHIRETYN

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	42	799	2.7e-112	0.7553191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.60e-108	50	848	10	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	2.61e-15	805	880	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.16e-13	707	800	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.57e-12	240	350	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	0.001	367	481	8	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69774.1	0.0	20	883	1	864
SCV09320.1	0.0	20	883	1	864
QRQ56624.1	0.0	20	883	1	864
ALJ44982.1	0.0	21	883	1	863
QDM08271.1	0.0	20	883	1	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	45	882	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	45	882	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	45	882	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	45	882	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	45	882	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	2.26e-129	55	878	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	2.90e-125	55	878	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	4.06e-125	55	878	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q5B7W2	3.14e-123	54	711	8	669	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1D911	1.39e-120	55	878	9	843	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.149823	0.531945	0.316134	0.001016	0.000664	0.000415

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_04858.