CAZyme Information: MGYG000000013_03515

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_03515
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000000013_9|CGC3	36542.15	9.1805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 73678; End: 74640 Strand: -

Full Sequence      

MLMLRKIVFFFFLFVGLSLFAQQNYMVSSYVRGNFYNRGRISTESLRASDDLIFLNVHPD
KDGSLSFENPRAFQGKGVTTWEGLIKSVRAKVKGTKAKIRLGASSGEWKAMVADETARTA
FARNIKKVLEKNKLDGIDLDFEWAENEKEYEDYSLAIVKMREVLGDKYIFSVSLHPVCYK
ISRKAIDAVDFISLQCYGPSPVRFPVEKYDSDIQMVLKYGIPKEKLVAGVPFYGVTKDNS
KKTEAYFSFVQEGLITEPAQNEVIYKGEKYVFDGQDNIRTKTRYAMEQGLKGMMSWDLAT
DLPLDDSKSLLKVMVEELRK

Enzyme Prediction     

No EC number prediction in MGYG000000013_03515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	49	307	7.2e-39	0.8918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	2.32e-29	52	301	29	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.09e-29	54	301	30	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	8.99e-27	36	301	11	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd00598	GH18_chitinase-like	1.67e-17	26	298	1	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06545	GH18_3CO4_chitinase	1.14e-16	65	312	28	251	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39890.1	4.07e-219	1	320	1	320
QGT72505.1	1.59e-216	1	320	1	320
ALJ47692.1	3.73e-215	1	320	1	320
QRQ54595.1	3.73e-215	1	320	1	320
SCV07090.1	3.73e-215	1	320	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	3.74e-18	52	301	39	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6TSB_AAA	1.24e-13	24	301	35	337	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.35e-13	24	301	54	356	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5XWQ_A	2.93e-08	50	320	23	370	Crystalstructure of chitinase (RmChi1) from Rhizomucor miehei (sp p32 2 1, MR) [Rhizomucor miehei],5YUQ_A Chain A, Chintase [Rhizomucor miehei],5YUQ_B Chain B, Chintase [Rhizomucor miehei],7FBT_A Chain A, Chitinase [Rhizomucor miehei]
1D2K_A	9.62e-08	105	301	99	348	ChainA, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W092	7.76e-11	105	301	131	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
C5P230	5.62e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P0CB51	5.62e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	5.62e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
A0A1B1J8Z2	7.10e-07	111	301	135	382	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008277	0.990374	0.000598	0.000233	0.000229	0.000254

TMHMM  Annotations     

start	end
7	26