CAZyme Information: MGYG000000013_02802

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02802
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	MGYG000000013_6|CGC9	86632.11	6.7559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 349917; End: 352184 Strand: +

Full Sequence      

MNLIKKRIFSLWASLCILCAVNAQETELTYCNKQIHKTLQAIGASSKIPRSMDAYKLHWN
MVSVDDWTSGFFPGVLWYDYEYSREPEIKEKAVYFTRLLEPLSHKVTSHDLGFQIFCSYG
NAYRLTKDKYYKDVILKSAEELSQLYNSRVGTILSWPWKVAENGWPHNTIIDNMMNLELL
FWASKNGGGKKYYDMALSHARVTKENHFRQDGSCYHVAVYDTISGKLIKGITHQGYSDRS
MWARGQAWAIYGYTMVYRETRDKDFLRFAEKVADLYISRLPADLIPFWDFDAPDIPAIPK
DASAAAVTASALLELSTLEDDPERSERYYALAKEMLHSLSSEHYQSRKKNSSFLLHSTGH
YPAGEEIDASIIYADYYYIEALMRWKKIEAKQALSQENKFIHPGILHTRESLERIRHYVD
QKINPAYQSYLLLQADPCASSDYQLQGPFEVIARLGVNSYTKRPSEDDHKAAYLNALMWT
ITGKEAHARKSIEILNAYSAVLRLIGPNDNDDPLCASLQGSMLANAAELIKHTYDKVEKK
DIASWEHMLRTVFIPVLDTFFKAKPYTNGNWGAAATKAYMAFGIFLDDESLYNQAVDFYY
NGHDNGTIKNYISESGQCQESGRDQDHVMFGLGNLSEVCETGYNQGDEKMYAALDNRLLT
GYEYTVKYNLGESVPFKVWTDISGRYCDWQVISEKERGAFRPIFEIVYNHYVTRKGLDMP
YTRRVMSKISIEGGSKWCDGPGYGTLLFRTQMNEK

Enzyme Prediction     

No EC number prediction in MGYG000000013_02802.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	63	384	8.4e-123	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.37e-14	44	259	6	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam05426	Alginate_lyase	1.78e-08	466	673	55	272	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR43442.1	0.0	3	754	1	752
QUT82307.1	0.0	3	754	1	752
QDM08388.1	0.0	3	754	1	752
QRQ56531.1	0.0	3	754	1	752
SCV09195.1	0.0	3	754	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	9.25e-93	66	391	72	397	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	8.78e-52	66	387	41	366	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2ZZR_A	1.44e-51	33	387	37	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.47e-51	33	387	38	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
2AHF_A	4.36e-51	66	387	41	366	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	4.12e-83	42	391	53	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	8.78e-52	66	387	69	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	4.81e-51	66	387	41	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8E372	8.05e-51	33	387	38	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	3.53e-49	66	387	66	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000703	0.996222	0.002474	0.000215	0.000177	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02802.