CAZyme Information: MGYG000000013_01146

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_01146
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1233	MGYG000000013_3|CGC2	140682.62	6.3106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 121832; End: 125533 Strand: -

Full Sequence      

MNRISKVFLACACSVLCMNGQAQSNATWTNDFSNAGETLKVVGRGTCSIADNVFRSKGAY
AVFGHPEWKNYSFSFKARAPKNAEQVQIWASFRNYNRFDRYVVGIKGGLQDDLYLMRTGY
MGTDEFMGVRPLGFHPVPGEWYRVKVEVCGNRIRIFLNDEKQPHIDLVDKNADLVPSGEV
ALGGGWIETEFDDLTVTPMADDALKNVKVAEYQKKATPAEKENKRCQERASYTSAKLAAL
TGSRTDITLDGNWLFMPDYQLDNKDKAVSVQTNDQDWHIMSVPNFWTPIRIWLHGETMPS
PTGAQPKGVSDTYYQQETDRCENYTFDYRRVKYAWYRQWLELPANVEGKNMTLTFDAVSK
IAEIYINGTLATSHLGMFGEIQVDGSHLLKPGKNLITVKVTRKMDGSASESANAIDFFYS
SVRESEQEDAKVEVNKDALLKEIPHGFYGDEPAGIWQPVKLTITDPAKVEDVFIKPTLNG
ATFDVTLKNHGSKKKQFDLYTDIIDKETGAVLYSGLSIRKLNLNADEERMETYTISDLKP
RLWTPQHPNLYDFKFRLVADKGTELDCLTETSGFRTFEVKDGLFYLNGNKYWLRGGNHIP
FALAPNDENLANTFMQLMKAGNIDVTRTHTTPWNKRWMTAADRNGIGVSFEGTWSWLMIH
STPIPDQRLIEIWRNEFLGLLKKYRNHPSLLFWTVNNEMKFYDNDSNLERAKEKYRIISD
VVKEMRRIDPTRPICFDSNYQAKGKDKKFGADFMSSIDDGDIDDMHGYYNWYDYSVFRFF
NGEFQKQFKVTDRPLISQEMSTGYPNNETGHPTRSYQLIHQNPYTLIGYESYDWADPASF
LKVQAFITGELAETLRRSNDQASGIMHFALMTWFRQTYDYQNIEPYPTYYALKRALQPVL
VSAELWGRNLYAGEKLPTRIYVVNDREDGTDLQPSLLRWEIQDESGKCLASGSEKIPAVK
HYARYYAEPDIQLPANLPADKTKAKLVLKLTENGLPISANEYELLLTNKEWNVGQVDPNK
KIVLLDKDNTKMVFDFLNINYQPISSIKELLNSKLKADLCVISGLTACTDEEKELIRAYQ
SKGGKLLFLNSKEAVKAIYPEYITGWIIPTEGDIVIMERNDAPVFNDIDVLELRYFNNNK
REIPQACTATLKVHRHKNVTELAGQMKIHAYIDGGKPEDRIERIESMRGLTMLQIADGKG
EAMISTMCTEKATTDPVAGKLVVNMINCLTTNK

Enzyme Prediction     

No EC number prediction in MGYG000000013_01146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	231	1035	5.7e-84	0.788563829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.40e-33	240	747	6	459	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.34e-29	335	734	66	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	7.59e-22	336	746	113	484	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	2.52e-13	467	575	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	1.24e-11	577	799	1	209	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71556.1	0.0	1	1233	1	1233
QIU96993.1	0.0	1	1233	1	1232
QDO68995.1	0.0	1	1227	1	1225
ALJ60854.1	0.0	1	1229	1	1227
QUT88128.1	0.0	1	1229	1	1227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	3.18e-23	247	698	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	3.18e-23	247	698	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6U7I_A	1.46e-21	304	775	40	476	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
6ED1_A	2.74e-21	245	772	25	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3GM8_A	1.51e-19	267	734	24	421	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.74e-22	247	698	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	2.12e-20	327	731	53	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
O52847	1.35e-18	248	698	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q04F24	2.32e-18	244	708	45	467	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
B4S2K9	5.29e-18	336	698	124	460	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000448	0.969915	0.028848	0.000284	0.000253	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_01146.