CAZyme Information: MGYG000000013_00697

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00697
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711	MGYG000000013_2|CGC8	82061.56	4.9573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 287543; End: 289678 Strand: +

Full Sequence      

MYTRLLFILLLGATWMCSCQTEQSPVNALADRVTEGTSKDRILFRMIADENNPLRDYFEI
SSEEGKVLITGNSDLSLATGLNWYLKYVAGIHLSWNNLSQKLPEILPLPQEKIRKETSMQ
DRYYLNYCTYSYSMAFWDWERWEKEIDWMAMHGINMPLSITGMEVVWYNLLKRLGYTTEE
VNEFISGPAFMAWWQMNNLEGWGGPNPDSWYQQQEALQKKIVARMRELGLEPVFPGYAGM
VPRNIGEKLGYQIADPGKWCGFPRPAFLSTEDEHFDSFAAMYYEELEKLYGKANYYSMDP
FHEGGNTEGVDLAKTGASIMAAMKKANPKAVWIIQAWQANPREEMIASLNQGDLLVLDLY
SEKRPQWGDPDSMWYREKGFGKHDWLYCMLLNFGGNVGLHGRMNQLVNGYYDACAHTNGK
TLHGVGATSEGIENNPVMFELLYELPWREERFSSDEWLQTYLKARYGREVSPEIMEAWRA
LEHTVYNAPKDYQGEGTIESLLCARPGFHLDRTSTWGYSKLFYAPDSTAKAARLFTSVAD
QYKGNNNFEYDLVDIVRQSNADKGNVLLEEISQSYDRKDKEDFRKQTQQFLDLILAQDRL
LSTRKEFSVSSWLNAARSLGTTEEEKRLYEWNASALITVWGDSIAANQGGLHDYSHREWS
GLLKDLYYQRWKAFFEQKQAELDGKPAGQEINFYGMEKAWAEKSKAQTLKN

Enzyme Prediction     

No EC number prediction in MGYG000000013_00697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	64	707	5.9e-249	0.9698340874811463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	122	449	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	9.87e-86	457	706	1	244	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	4.95e-22	24	107	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55998.1	0.0	1	711	1	711
ALJ49197.1	0.0	1	711	1	711
QUT82989.1	0.0	1	711	1	711
SCV08615.1	0.0	16	711	1	696
QDM11879.1	0.0	7	711	7	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	6.73e-169	24	703	172	849	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	8.43e-169	24	703	180	857	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.00e-167	24	703	195	872	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	8.69e-109	66	676	51	657	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	3.38e-120	66	685	94	758	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	4.29e-108	66	676	74	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000054	0.032359	0.967545	0.000015	0.000021	0.000015

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00697.