CAZyme Information: MGYG000000012_03380

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_03380
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000000012_4|CGC2	97415.4	6.3862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 170788; End: 173361 Strand: +

Full Sequence      

MKRIKWLSEQPKVTSGVTWGVPWKKGECKKGDRLALLNENAAIRYVQSEPSSYWPDGSIK
WTKHAAVFGGQENQSFTVQKGEAPQPTKSISIHESAHDIQVDTGTLVCTIHQTGFDFIQS
LQINGKPIAAGGRLVAIRETRKESAAETVLFQETSVSLIKQAAIEQSGPVKAVVKIEGVH
MLHKTNEEWLPFVIRLTFYAGLSEIGLVHTQLIDRSGKQEFIKGIGIEFDLFLEGEPYNR
HFRFAGEKGMYKEPAQLFGTRKFNERYPLYEKQINGETLSPDEEHKEWFAHGTQNAVWDE
VKLVQDSSDHYSLSKRTGKDYAWVGMLHGSRAKGLCYAGGENGGVALGLRYFFEKYPSAL
EITGLAGSRPKMTVWLWPPDGEAMDLRHYTGHTHVASAYEGFDEMRADPTGIANTNEISL
ACFSHMPSDDVFNALADKWQAPPLLVCEPNVYYESKALGVWSIIDTSHPLKKELEEQLDA
AFLFYKKEVEQRKWYGFWHYGDVMHTYDPIRHMWRYDLGGYAWQNNELVPTLWLWQAFFR
SGREDIFRMAEAMTRHTSETDSFHLGEYAGLGTRHNVVHWGCGCKEARISMAGLYKFYYY
LTGDERTGDLLTEVKDADYALVKTDPMRAFYEKGKHPTHVRTGPDWAAFCSNWLAEWERT
ENPEYLKKIKTGINCLKQLPLRLLSGPTFEYDPATSMLHHMGDGIAGGYHMIIAFGAPQV
WMELAELLDDREWEDMLSEFGEFYTLSDEEKRKKSGGALHDGHFHWPMFAAAMTAYAARK
KQDPNLAAKAWNLLLDDKLSHTPLPIKPERIETWTQLEELPWVTTNTVSQWCLNVITALE
LIGDSLPAKKETSGKKG

Enzyme Prediction     

No EC number prediction in MGYG000000012_03380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	3	846	0	0.9976798143851509

CDD Domains     

MGYG000000012_03380 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS12978.1	0.0	1	857	1	857
AXP47396.1	0.0	1	857	1	857
ASB60015.1	0.0	1	857	1	857
QRZ93678.1	0.0	1	857	1	857
AUZ37631.1	0.0	1	857	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	8.54e-148	4	846	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	1.29e-146	4	846	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	1.36e-146	4	846	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	3.58e-146	4	846	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	0.0	1	857	1	857	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000012_03380.