CAZyme Information: MGYG000000010_01003

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01003
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000000010_6|CGC4	55178.86	4.4763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 103091; End: 104530 Strand: +

Full Sequence      

MAKLDKNFLWGGALAANQFEGGYDQGGKGLSVHDVMTAGEHGKAREITETIEDDKFYPNH
DGIDFYNRYKEDIALFGEMGLKCLRTSIAWTRIFPNGDEAEPNEEGLQFYDNIIDELLKY
NIEPVLTLSHFEMPLHLAREYGGFRNRKVVDYFVRFAETVFNRYKDKVKYWMTFNEINNQ
MDTSNPIFLWTNSGVTLAEDEDPEEVLYQVAHNELIASALAVSKGKEINPDFIIGNMISH
VPIYPYSCNPNDIMEAEIANRLRFFFPDVQVRGYYPGYALKMFEKNGYDIKWQEGDDEIL
KNGTVEYIAFSYYMSTVVKHDEVTSVEDNVVNGGLPNSVKNPYIKESQWGWAIDPVGLRY
TLNVLYNRYQLPLFIVENGFGTTDEFKEDGTIDDQERIDYLREHIKASIQAVDEDGVDLM
GYTPWGIIDIVSFTTGEMKKRYGLIHVDRDNEGNGTLKRTKKNSFYWFNNVIKTNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	476	1e-144	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	479	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	479	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	479	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	478	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	6	479	8	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU09474.1	0.0	1	479	1	479
QRO86264.1	0.0	1	479	1	479
QTN11111.1	0.0	1	479	1	479
QPW15475.1	0.0	1	479	1	479
QYG32260.1	0.0	1	479	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.13e-218	4	479	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.25e-211	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.27e-211	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	4.46e-204	2	479	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	2.41e-191	3	479	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	2.19e-272	1	479	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	6.17e-218	4	479	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	2.19e-184	3	479	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.07e-173	1	479	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	4.48e-170	6	479	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000010_01003.