CAZyme Information: MGYG000000008_01469

Basic Information

• Species: Lactobacillus johnsonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus johnsonii
• CAZyme ID: MGYG000000008_01469
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	MGYG000000008_14|CGC1	27746.16	10.2773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000008	1971706	Isolate	United Kingdom	Europe

• Gene Location: Start: 34570; End: 35331 Strand: +

Full Sequence      

MKENKSQDNKEPKGPYKHFERPKTSRRAMHHRESEPEADPEVTSRKSTQSEGSPKGPHHS
QLWAGLIIVAIIIIALIPIVSSRLHANSNNLAEKSVKVSKSSSSKSHKPKSKKSKQSSSK
KSKSKSSSVKREESSSSQSQDTTPAVVSQSESQSSQVSQSSTQSYESSASQTTTQDQSQQ
SAQNTTQTNQNTWQNNGGSSYSQHEAPRSYTVQEGDSLSKIARENNTSVHHLEQINDLES
ADSISIGQSIKLR

Enzyme Prediction     

No EC number prediction in MGYG000000008_01469.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.83e-11	208	252	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	3.06e-10	210	252	2	44	Lysin motif.
pfam01476	LysM	1.48e-09	210	252	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	3.53e-06	210	253	69	111	LysM repeat [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	7.24e-06	208	252	344	387	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXL46964.1	3.79e-108	1	253	1	255
QGY96710.1	3.79e-108	1	253	1	255
AZZ67677.1	3.79e-108	1	253	1	255
ARW77126.1	2.53e-106	1	253	1	255
ARW74913.1	2.53e-106	1	253	1	255

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999867	0.000119	0.000005	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
62	84