CAZyme Information: MGYG000000003_00663

Basic Information

• Species: Alistipes shahii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes shahii
• CAZyme ID: MGYG000000003_00663
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000003_1|CGC6	38391.29	9.3329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000003	3229518	Isolate	United Kingdom	Europe

• Gene Location: Start: 774719; End: 775723 Strand: -

Full Sequence      

MTFSKKAILLSGILLCISVQLGAQVRQTREEYISRYMPIAIAHMERYGIPASITMAQGIL
ESDCGNSLLSMKSNNHFGIKCKRNWTGDKVYHDDDAKGECFRSYPSVEASYRDHAEFLDS
QPRYDSLFAYSSDDYKSWARGLKAAGYATAPDYAQRLIRIIEENQLFLLDRPDGARLYAS
RYGLKRDPEEWFSSQSSVEELARTEGAVDPDNYRVTINAHQGYNVYVTNGVHYVLAKEND
TFENIGRKFRLSPRNLRKFNDLKDKKAQPVPGEAVYIERKRKRWEGNSRHHICRQGETAY
SVGQSYAIRTRSIEKLNKLRKDEELAAGREIRIK

Enzyme Prediction     

No EC number prediction in MGYG000000003_00663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	37	166	9.7e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.90e-37	1	180	8	198	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	8.30e-37	26	170	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	9.56e-28	38	166	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	5.53e-25	29	161	152	294	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	7.89e-25	24	162	3	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64601.1	4.22e-244	1	334	1	334
BBL07002.1	1.33e-199	1	334	1	334
BBL09489.1	3.23e-198	1	334	1	335
BBL12282.1	3.23e-198	1	334	1	335
BBL01630.1	3.23e-198	1	334	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	4.26e-16	30	166	2	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.20e-16	30	166	3	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.53e-15	30	166	3	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	2.47e-08	30	163	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.17e-08	30	163	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	9.70e-17	30	160	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.28e-16	28	174	160	317	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
O32083	1.63e-13	45	166	64	194	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9I4P4	2.08e-13	22	167	232	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	1.06e-07	37	163	158	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002743	0.996130	0.000542	0.000189	0.000187	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000003_00663.