CAZyme Information: MGYG000000003_00402

Basic Information

• Species: Alistipes shahii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes shahii
• CAZyme ID: MGYG000000003_00402
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000000003_1|CGC2	40970.96	4.962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000003	3229518	Isolate	United Kingdom	Europe

• Gene Location: Start: 460677; End: 461744 Strand: +

Full Sequence      

MIMRKTAIFWVLVLLLTGCSKGIGSDGKWTSEKANKWYERTGWRSGCDYIPANAINQIEM
WSNSTFDAETIDRELGWAEDLGFTTARVYLSSVVWQHEPETFKARMDEFLTISDRHGIKP
VFVFFDDCWNAESEYGPQPEPRPGVHNSGWVRDPAQSLRADTTALYPVLEAYVKDVLNTF
KNDSRILWWDLYNEPGNSNNGNSSLPLLKKVFHWAHEVRPSQPVSVGIWTDAFPELSEFQ
AENSDIISYHDYRSPEKHLARIESLRKYGRPIVCTEYMARKNDCTFQNTLPMLKEQHVSA
INWGFVAGKTNTIFAWDDPRPDEAEPELWFHDIYRTDRTPFSEEEIAVIRAVNGL

Enzyme Prediction     

No EC number prediction in MGYG000000003_00402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	312	1.4e-110	0.9963636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02836	Glyco_hydro_2_C	4.73e-05	108	279	63	212	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
COG3934	COG3934	1.02e-04	55	261	14	209	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
cd09858	PIN_MKT1	0.004	99	193	55	134	FEN-like PIN domains of Mkt1, a global regulator of mRNAs encoding mitochondrial proteins and eukaryotic homologs. The Mkt1 gene product interacts with the Poly(A)-binding protein associated factor, Pbp1, and is present at the 3' end of RNA transcripts during translation. The Mkt1-Pbp1 complex is involved in the post-transcriptional regulation of HO endonuclease expression. Mkt1 and eukaryotic homologs are atypical members of the structure-specific, 5' nuclease family (FEN-like). Canonical members of the FEN-like family possess a PIN domain with a two-helical structure insert (also known as the helical arch, helical clamp or I domain) of variable length (approximately 16 to 800 residues), and at the C-terminus of the PIN domain a H3TH (helix-3-turn-helix) domain, an atypical helix-hairpin-helix-2-like region. Both the H3TH domain (not included in this model) and the helical arch/clamp region are involved in DNA binding. Although Mkt1 appears to possess both a PIN and H3TH domain, the Mkt1 PIN domain lacks several of the active site residues necessary to bind essential divalent metal ion cofactors (Mg2+/Mn2+) required for nuclease activity in this family. Also, Mkt1 lacks the glycine-rich loop in the H3TH domain which is proposed to facilitate duplex DNA binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ11910.1	8.25e-154	8	354	4	348
QNL39429.1	9.97e-152	3	352	1	355
QJT73071.1	2.75e-151	5	354	4	355
SDT13937.1	8.13e-151	29	354	32	356
QDH52948.1	3.29e-150	3	352	1	355

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000182	0.999892	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000003_00402.