CAZyme Information: MGYG000000003_00400

Basic Information

• Species: Alistipes shahii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes shahii
• CAZyme ID: MGYG000000003_00400
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000000003_1|CGC2	87083.79	5.015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000003	3229518	Isolate	United Kingdom	Europe

• Gene Location: Start: 456547; End: 458895 Strand: +

Full Sequence      

MSFARCDFDDSSWESVTVPHDWAIYGPFDRENDLQDVLVAQNLETRPTLKTGRTGGLPYI
GTGWYRRMIDTGIEPGSGRRAIVVFDGAMSEARVYVNGTEVIFWPYGYNSFWCDITDALH
TDGTSDVLAVRLENRPNSSRWYPGAGLYRNVHLLTVSDSHIPVWGTYITTPEVTSGRASV
HVETQVAAGTGARLSLRTDILGPDGDLLASSESPVTGVSVAQDFAVGSPRLWSPETPVLY
KAVSRLFDGQVLVDRYETVFGIRSLEYIPEKGFFLNGESRKFQGVCNHHDLGPLGAAVNE
AALRRQITMLKDMGCDAIRTSHNMPAPDLVRLCAEMGMMIMVESFDEWDIAKCGNGYHRF
FDEWAEKDMVNMLRQFRSNPAVVMWSIGNEVPSQRSPEGWKTVEFLQDICHREDPTRPVT
CGMDQTSHVLQNGFAATVDIPGINYHPWDYVKAHDVLPQGFILGSETASTVSSRGVYHFP
VEKVLSHCTSDRQSSSYDFDACSWSNLPDVDFALADDYPWTMGQFVWTGFDYIGEPSPYD
TDCWPSHSSVFGIIDLAFIPKDRYYLYRSVWNRTEPTLHVLPHWNWTEGQHVPVFVYTSY
PEAELFVNGVSHGRRKKAVPTAPTGGLREEPTEERYRLMWKDVVFSPGELKAVAYDAEGN
AVAEKCVHTAGEPHHIELQADRTTLSADGKDLAYVTVSVVDKDGNLCPDYDGLLEFGVSG
AASYRASANGDPTCLDLFHLPQMHAFHGMLTVIVQAGERPGTARLTVGGKGLDTCKLRLN
IK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	572	4.8e-106	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.22e-52	11	743	40	778	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	4.90e-40	676	778	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	3.12e-39	59	421	63	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.26e-25	3	419	63	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	9.83e-21	589	665	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26130.1	0.0	13	782	39	799
VDS02704.1	0.0	8	782	20	785
VDS02460.1	0.0	8	782	20	785
VTZ55418.1	0.0	8	782	20	785
VTZ55175.1	0.0	8	782	20	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	6.52e-231	8	782	49	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	3.47e-176	8	774	28	794	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.01e-170	8	774	34	802	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CU6_A	3.41e-130	7	766	37	829	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	9.41e-130	7	766	37	829	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.50e-171	1	780	59	847	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.11e-94	3	732	65	770	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	1.50e-46	7	729	49	745	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	6.69e-43	9	733	75	782	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	7.59e-42	5	720	24	689	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000003_00400.