CAZyme Information: MGYG000000001_00167

Basic Information

• Species: GCA-900066495 sp902362365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp902362365
• CAZyme ID: MGYG000000001_00167
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000001_1|CGC3	65669.01	4.7804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000001	3219617	Isolate	United Kingdom	Europe

• Gene Location: Start: 183065; End: 184834 Strand: +

Full Sequence      

MVNLKAKPYYLDEEGISWVEETLESMTIEEKIGQLFINMGSSTEEEYLKNSLEKYKFGAV
RYNPGPADKVLEQNRILQENSKIPLLIAANAESGGNGAFMGGTEIATPIKIGATRNVEYA
YEMGRVSGIECAAIGANWTFAPVTDIMLNWRNPVIQTRTFGDDASRVLEMSKAYMKGFME
SNGICAMKHFPGDGVDERDQHLSNSSNSLSCEEWDNTFGKVYSGMIDAGIHSIMVGHIML
PSYERKYNKDLAEGGEIMPATVSKAIITDLLKGQLEFNGLVVTDASHMAGLTSRMKRSDM
LPASIAAGCDLFLFFNDPDEDFGYMMDGYKNGIITDERLNDAIRRILGTKAYLGLHKKDK
KDIVPPKEGLSVIGSEEFKNIAKEISDEAITLVKNVDKSILPISVEKNKRILLIEQEISN
PVMALFVGAGNKKTFTEYFKEKLEAEGFEVDIYESPIDKVKRVSKEEAGKIMMNAYSAKA
PITDLTDKYDLVIQLASIYNAAGTTQRIEWKMSKGTPDIPWYVHELPTIFVSLCSPFHLA
DVPQVKTYINCYDKNEHTLDALVEKLLGRSEFKGVDPVDSFCGLEDTRW

Enzyme Prediction     

No EC number prediction in MGYG000000001_00167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	3.8e-51	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.21e-62	26	416	1	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.43e-58	27	347	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.66e-21	118	319	97	284	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.48e-20	19	414	38	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10123.1	0.0	1	589	1	589
QFK71386.1	8.55e-263	2	587	4	586
SQI02299.1	1.45e-261	1	589	1	589
ASY50254.1	2.06e-261	1	589	1	589
AWS24750.1	2.06e-261	1	589	1	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.24e-139	4	588	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	3.16e-45	21	579	37	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.11e-44	21	579	11	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.60e-44	21	579	41	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	3.25e-36	24	577	9	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	3.69e-138	1	587	1	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.73e-44	21	579	37	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.44e-22	73	395	88	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A7LXU3	2.15e-22	19	413	39	439	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q7NWB7	2.39e-21	85	320	61	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000001_00167.